General Information

  • ID:  hor006880
  • Uniprot ID:  P02652??20-100)
  • Protein name:  Proapolipoprotein A-II
  • Gene name:  Apoc3
  • Organism:  Homo sapiens
  • Family:  Apolipoprotein A2 family
  • Source:  Animal
  • Expression:  Plasma; synthesized in the liver and intestine.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0072562 blood microparticle; GO:0042627 chylomicron; GO:0005829 cytosol; GO:0005769 early endosome; GO:0005788 endoplasmic reticulum lumen; GO:0070062 extracellular exosome; GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0034364 high-density lipoprotein particle; GO:0034366 spherical high-density lipoprotein particle; GO:0034361 very-low-density lipoprotein particle
  • GO BP:  GO:0008035 high-density lipoprotein particle binding; GO:0031210 phosphatidylcholine binding; GO:0060228 phosphatidylcholine-sterol O-acyltransferase activator activity; GO:0005543 phospholipid binding; GO:0019899 enzyme binding; GO:0055102 lipase inhibitor activity; GO:0120020 cholesterol transfer activity; GO:0070653 high-density lipoprotein particle receptor binding; GO:0046982 protein heterodimerization activity; GO:0008289 lipid binding; GO:0034190 apolipoprotein receptor binding; GO:0005102 signaling receptor binding; GO:0048018 receptor ligand activity; GO:0005319 lipid transporter activity; GO:0031072 heat shock protein binding; GO:0042803 protein homodimerization activity; GO:0015485 cholesterol binding
  • GO CC:  GO:0060192 negative regulation of lipase activity; GO:0043691 reverse cholesterol transport; GO:0002719 negative regulation of cytokine production involved in immune response; GO:0034370 triglyceride-rich lipoprotein particle remodeling; GO:0008203 cholesterol metabolic process; GO:0034380 high-density lipoprotein particle assembly; GO:0046340 diacylglycerol catabolic process; GO:0030301 cholesterol transport; GO:0009410 response to xenobiotic stimulus; GO:0042632 cholesterol homeostasis; GO:0033344 cholesterol efflux; GO:0071402 cellular response to lipoprotein particle stimulus; GO:0031100 animal organ regeneration; GO:0034384 high-density lipoprotein particle clearance; GO:0009749 response to glucose; GO:0006641 triglyceride metabolic process; GO:0043627 response to estrogen; GO:0050995 negative regulation of lipid catabolic process; GO:0051384 response to glucocorticoid; GO:0032375 negative regulation of cholesterol transport; GO:0060621 negative regulation of cholesterol import; G

Sequence Information

  • Sequence:  LVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
  • Length:  81
  • Propeptide:  MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
  • Signal peptide:  MKLLAATVLLLTICSLEG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA